1/6

Use to navigate. Pressesc to quit
Stylized Demon Sword Low-poly 3D model
thumbnail
thumbnail
thumbnail
thumbnail
thumbnail
thumbnail
DESCRIPTION

A fearsome, game-ready 3D model of a stylized demon sword, perfect for dark lords, demonic enemies, or epic final bosses. Modeled in Maya with clean, all-quad topology and textured in Substance Painter.

This sword features a black jagged blade with glowing red lines, a horned crossguard, and an eye motif in the hilt. The dark, menacing design makes it ideal for villainous characters, end-game loot, or cursed weaponry.

The model includes 2K PBR textures with base color, roughness, metalness, normal, and emissive maps, all in PNG format following the metal/rough workflow. UVs are non-overlapping and optimized.

Fully game-ready with clean geometry. Suitable for Unity, Unreal Engine, or any real-time application.

Includes Maya, FBX, and OBJ formats.

Related Tagsdemonswordfantasydarkweaponevilbossgame readycurseddemonicgothicblackmagicrpggamereadymedievalglowingbloodknight

REVIEWS & COMMENTS

See what other buyers think about this model - real feedback on quality,
accuracy, and usability.
There are no reviews or comments yet. Please be the first one to write it.
BEST PRICE GUARANTEED
Found this model cheaper on another marketplace? Let our support team know - we’ll match it.
NEW
Recently added to CGTrader - explore one of the latest models on the marketplace.
CGT STANDARD
This model passed automated CGT Standard checks and meets professional, PBR ready standards.

Stylized Demon Sword Low-poly 3D model

$5.00
Royalty Free License
Created by
A
ABSolute3D
(0 reviews)
Hire
Like this model to show appreciation to the designer.
See how many times this model was viewed.
Share this model to support the designer and boost their visibility.
Native file format
MA2 files
Size: 1.11 MB
Arnold 2026 | 2026
Arnold 2026 | 2026
Exchange formats
OBJ
OBJ<br />Version: 2026<br />File Size: 564 KB
FBX
Autodesk FBX<br />Version: 2026<br />File Size: 217 KB
PNG
PNG<br />Version: 2026<br />File Size: 9.1 MB
Verified by CGTrader
Verified models are of higher quality as they have
passed CGT Standard technical and visual checks,
making them more professional-grade 3D assets.
Learn more.
FBX
This FBX file has successfully passed the CGT Standard technical and visual checks. The verification results are detailed in the section below.
File & scene
Binary FBX
Binary FBX file is more compact and faster to load and process.
Learn more
No unsupported objects
Unsupported objects:
- Lights
- Cameras
Learn more
Geometry
No N-gons
N-gons are polygons with five or more sides which might cause issues in certain processes like rendering or animation. Learn more
No faceted geometry
Faceted geometry uses flat surfaces without smoothing, which can look unrealistic on curves.
Learn more
Manifold geometry
Manifold geometry ensures all surfaces are properly connected, avoiding issues like edges shared by more than two faces.
Learn more
Textures & material
PBR textures
PBR textures simulate how light interacts with materials, making the model look realistic under different lighting.
Required PBR textures:
- Base Color
- Roughness
- Metalness
- Normal
Learn more
No embed textures
Embedded textures are stored inside the model file, increasing its size and sometimes causing compatibility issues.
Learn more
Square textures
Texture aspect ratio is the width-to-height ratio of a texture. Expected texture aspect ratio: 1:1
Learn more
Power of 2 texture sizes
Textures with dimensions in power of two (e.g. 512x512px, 1024x1024px) are used to optimize performance and memory usage.
Learn more
Assigned materials
Materials are applied to the 3D model to allow visualize a model's surface properties and appearance.
Learn more
UVs & naming
No UV overlaps
UVs overlap when multiple points on the 3D model's surface are mapped to the same point on the UV island causing texture stretching.
Learn more
UV unwrapped model
A UV unwrapped model means its 3D surface is flattened into 2D space, allowing textures to be applied accurately.
Learn more
Allowed characters
Allowed ASCII characters: a-zA-Z0-9-_
Learn more
Provided by designer
Information and details shared directly by the model's designer.
3D Features
PBR
Uses Physically Based Rendering materials, which give the model realistic lighting and surface properties.
Textures
The model includes image files (textures) that add color, patterns, or detail to its surfaces.
Materials
The model has material settings that define how surfaces look (color, shine, transparency, etc.).
UV Mapping
The model's surfaces are mapped to a 2D image, allowing textures to display correctly.
Plugins Used
Some external plugins were used to create the model. These may be required for full functionality.
3D printing
Indicates whether the designer marked this model as suitable for 3D printing.
Model is not 3D printable
The designer indicates this model is intended for digital use only (rendering, animation, or AR/VR) and not for 3D printing.
Geometry
Polygon mesh
A model built from polygons (triangles or quads) connected in a mesh.
2484 polygons
The total number of polygons (flat shapes) that make up the 3D model.
/
4676 vertices
The number of points (corners) that define the shape of the model's polygons.
Unwrapped UVs
Non-overlapping
Publish date
2026-08-01
Model ID
#7413050
This model is also available in packs
item
Stylized Fantasy Weapons Pack 9 Game-Ready Models
9 items
$45.00$31.50
Chat